PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676776596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WOX
Protein Properties Length: 464aa    MW: 51632.8 Da    PI: 7.6736
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676776596genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.9e-1853113257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  676776596  53 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 113
                89*****************99*************************************995 PP

2Wus_type_Homeobox1123.3e-3652114264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
          676776596  52 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 114
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.68949114IPR001356Homeobox domain
SuperFamilySSF466894.71E-1250117IPR009057Homeodomain-like
SMARTSM003891.2E-851118IPR001356Homeobox domain
CDDcd000866.76E-952114No hitNo description
Gene3DG3DSA:1.10.10.601.5E-653112IPR009057Homeodomain-like
PfamPF000461.2E-1553113IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHHHQ WQHDINSPLL PSPASHRSSP FSGCEVERSP EPKPRWNPKP  60
EQIRILEAIF NSGMVNPPRE EIRRIRAQLQ EYGQVGDANV FYWFQNRKSR SKHKLRLLHN  120
HSKHSLPQPQ QQPQSEPLSS ANSASSSSSS SSSSSKSTKP RKNKNNNNNN NNNNNNNTSL  180
SLGGSQMMGM FPPEASFLFP VSTIGGFGGI AVSSQLGFLS GDMIEQPKPA PPTAGPCTGL  240
LLSDIMNGSV GYGTHHHQQL SDKEDEEMRM RMLQQTQPQI CYATTSHQIS SYNNNNNIML  300
HVPPTTSTTT TITTSDSLAI VPSTSDQLQV QAGARIRVFI NEMELEVSPG PFNVRDAFGE  360
EVVLINSAGQ PIVTDDYGVA IHPLQHGASY YLYNSNILED VPPCEYILIS NRVGKLELKM  420
KSRPVSFFHY LAYCLDCDVR FTCGKCGDFE FSPREVILHF NPGD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1185011e-171AK118501.1 Arabidopsis thaliana At2g33880 mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL19-73-K21.
GenBankAY2514011e-171AY251401.1 Arabidopsis thaliana WOX9 protein mRNA, complete cds.
GenBankBT0052961e-171BT005296.1 Arabidopsis thaliana At2g33880 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410541.10.0hypothetical protein EUTSA_v10016784mg
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLV4M6W20.0V4M6W2_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0004_18720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-106homeobox-3